PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01022.1.p
Common NameEUGRSUZ_E01022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 718aa    MW: 79035.8 Da    PI: 6.7715
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01022.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28312362252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Eucgr.E01022.1.p 312 EKCISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKISKV 362
                       789*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.677301382IPR003035RWP-RK domain
PfamPF020421.4E-25315362IPR003035RWP-RK domain
SuperFamilySSF542771.08E-22617706No hitNo description
Gene3DG3DSA:3.10.20.2407.6E-26622704No hitNo description
PROSITE profilePS5174525.629622704IPR000270PB1 domain
SMARTSM006666.2E-26622704IPR000270PB1 domain
PfamPF005644.4E-18622703IPR000270PB1 domain
CDDcd064074.52E-35623703No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MLDIKILQWF AFSFFLHRLL NQICNEGRHN ALAEILEILT VTCETHKLPL AQTWVPCQHR  60
SVLANGGGLK KSCSSIDGSC MAQVCMSTTD VAFYVVDAHM WGFREACVEH HLQKGQGVAG  120
RAFLSQSSCF SKDITQFCKS EYPLVHYARM FGLTSCFAIC LRSSHTGNDD YILEFFLPPG  180
ITNSGEQQSL LSSLLSTMRK HFKSLMVASG KTLQLEDKSI EFIEAVLNER LDSRVDSLQI  240
PTYTELLAGP LYLPNGGVAR QLDSSKQLLV DIVDVINDEV NPVMAIASEN VVTFPENNVM  300
KKKSEKRRGK AEKCISLEVL QQYFAGSLKD AAKSLGVCPT TMKRICRQHG ISRWPSRKIS  360
KVNRSLSKLK HVIESVHGAE ETFSISALAT SPLPIAVGSI SWPPSLKESN ELNPPQAKAL  420
EAQGEGMNRS PSKLPRTDEE AAVQNKSYER VPQEEQLLNE HGRSSPEFAG APSRSKSRSG  480
SREQSAGTPT SHGSCQGSPA NESLPVKDQS GSPHNDQCIK RGGSLEVMFK STNAQNFSAA  540
YSMPDALGVT ELQEPFGGML IEDTGSSKDL RNLCPSVADA VLEDRVPESS RTNPPCSDMA  600
SKQAATFLRT TPRTTPRQDM TTVTIKATYR EDIIRFRISL SSSIVELREQ VAKRLKLEVG  660
TFDIKYLDDD HEWVLVACDA DWQECMDFSR SSGCNMIRLL VHDVMANLGS SCESSGE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01022.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055982.10.0PREDICTED: protein NLP6 isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A059C2690.0A0A059C269_EUCGR; Uncharacterized protein
STRINGVIT_02s0025g02070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25072666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7